SPZ1 (NM_032567) Human Recombinant Protein

CAT#: TP307443

Recombinant protein of human spermatogenic leucine zipper 1 (SPZ1)

Product Images

Coomassie blue staining of purified SPZ1 protein (Cat# TP307443). The protein was produced from HEK293T cells transfected with SPZ1 cDNA clone (Cat# RC207443) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207443 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSAKSAEMPTISKTLNPTPDPHQEYLDPRITIALFEIGSHSPSSWGSLPFLKNSSHQVTEQQTAQKFN
  NLLKEIKDILKNMAGFEEKITEAKELFEETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEK
  KQEMILETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQQMIMENQNSENTAQVFARDL
  VNRLEEKKVLNETQQSQEKAKNRLNVQEETMKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKSQKDISE
  TLGNNGVGFQTQPNNEVSAKHELEEQVKKLSHDTYSLQLMAALLENECQILQQRVEILKELHHQKQGTLQ
  EKPIQINYKQDKKNQKPSEAKKVEMYKQNKQAMKGTFWKKDRSCRSLDVCLNKKACNTQFNIHVARKALR
  GKMRSASSLR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115956
• Locus ID: 84654
• UniProt ID: Q9BXG8, A0A140VKA5
• Cytogenetics: 5q14.1
• Refseq Size: 1873
• Refseq ORF: 1290
• Synonyms: CILD38; NYD-TSP1; PPP1R148
• Summary: This gene encodes a bHLH-zip transcription factor which functions in the mitogen-activate protein kinase (MAPK) signaling pathway. Because of its role in the upregulation of cell proliferation and tumorigenesis, this gene may serve as a target for Ras-induced tumor treatments. [provided by RefSeq, Oct 2011]