CESK1 (CCT8L2) (NM_014406) Human Recombinant Protein

CAT#: TP307536

Recombinant protein of human chaperonin containing TCP1, subunit 8 (theta)-like 2 (CCT8L2)

Product Images

Coomassie blue staining of purified CCT8L2 protein (Cat# TP307536). The protein was produced from HEK293T cells transfected with CCT8L2 cDNA clone (Cat# RC207536) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207536 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSTVPSALELPQRLALNPRESPRSPEEEEPHLLSSLAAVQTLASVIRPCYGPHGRQKFLVTMKGETVCT
  GCATAILRALELEHPAAWLLREAGQTQAENSGDGTAFVVLLTEALLEQAEQLLKAGLPRPQLREAYATAT
  AEVLATLPSLAIQSLGPLEDPSWALHSVMNTHTLSPMDHLTKLVAHACWAIKELDGSFKPERVGVCALPG
  GTLEDSCLLPGLAISGKLCGQMATVLSGARVALFACPFGPAHPNAPATARLSSPADLAQFSKGSDQLLEK
  QVGQLAAAGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPRLLPPQRPGKCQRV
  YRQELGDGLAVVFEWECTGTPALTVVLRGATTQGLRSAEQAVYHGIDAYFQLCQDPRLIPGAGATEMALA
  KMLSDKGSRLEGPSGPAFLAFAWALKYLPKTLAENAGLAVSDVMAEMSGVHQGGNLLMGVGTEGIINVAQ
  EGVWDTLIVKAQGFRAVAEVVLQLVTVDEIVVAKKSPTHQEIWNPDSKKTKKHPPPVETKKILGLNN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 59.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055221
• Locus ID: 150160
• UniProt ID: Q96SF2
• Cytogenetics: 22q11.1
• Refseq Size: 2065
• Refseq ORF: 1671
• Synonyms: CESK1
• Summary: Possible molecular chaperone; assists the folding of proteins upon ATP hydrolysis.[UniProtKB/Swiss-Prot Function]