FASTK (NM_033015) Human Recombinant Protein
CAT#: TP307877
Recombinant protein of human Fas-activated serine/threonine kinase (FASTK), transcript variant 4
View other "FASTK" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207877 protein sequence
Red=Cloning site Green=Tags(s) MRRPRGEPGPRAPRPTEGATCAGPGESCFPSDGPLVCALEQERRLRLPPKPPPPLQPLLRGGQGLEAALS CPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKLV LPFGRLNYLPLEQQFMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPHA LIVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQD LTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRDG RVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_148936 |
Locus ID | 10922 |
UniProt ID | Q14296, A0A090N8I0 |
Cytogenetics | 7q36.1 |
Refseq Size | 1448 |
Refseq ORF | 1224 |
Synonyms | FAST |
Summary | The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409778 | FASTK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416471 | FASTK HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409778 | Transient overexpression lysate of Fas-activated serine/threonine kinase (FASTK), transcript variant 4 |
USD 396.00 |
|
LY416471 | Transient overexpression lysate of Fas-activated serine/threonine kinase (FASTK), transcript variant 1 |
USD 396.00 |
|
PH307877 | FASTK MS Standard C13 and N15-labeled recombinant protein (NP_148936) |
USD 2,055.00 |
|
TP762102 | Purified recombinant protein of Human Fas-activated serine/threonine kinase (FASTK), transcript variant 1,Leu200-Gln535, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review