MYBPH (NM_004997) Human Recombinant Protein

CAT#: TP308162

Recombinant protein of human myosin binding protein H (MYBPH)

Product Images

Coomassie blue staining of purified MYBPH protein (Cat# TP308162). The protein was produced from HEK293T cells transfected with MYBPH cDNA clone (Cat# RC208162) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208162 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMEKNTSEGPACSPEETASESAKVPTAEPPGEVAVSESTREEQVPKPQAPAPQAPTASTATKPAPPSEDV
  PSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPVSARPMMVTQQTVRNLALGDK
  FLLRVSAVSSAGAGPPAMLDQPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTH
  NGHALDSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWG
  CNAALQWTPPQDTGNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGLST
  SATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRASPKPKIIWMKNKM
  EIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCRLEVKASAAH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 51.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004988
• Locus ID: 4608
• UniProt ID: Q13203
• Cytogenetics: 1q32.1
• Refseq Size: 1806
• Refseq ORF: 1431
• Summary: Binds to myosin; probably involved in interaction with thick myofilaments in the A-band.[UniProtKB/Swiss-Prot Function]