UGP2 (NM_006759) Human Recombinant Protein
CAT#: TP308376
Recombinant protein of human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208376 protein sequence
Red=Cloning site Green=Tags(s) MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKG PSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVM EVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDM EIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPP GAVLENKIVSGNLRILDH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006750 |
Locus ID | 7360 |
UniProt ID | Q16851 |
Cytogenetics | 2p15 |
Refseq Size | 2185 |
Refseq ORF | 1524 |
Synonyms | DEE83; EIEE83; pHC379; SVUGP2; UDPG; UDPGP; UDPGP2; UGP1; UGPP1; UGPP2 |
Summary | The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Starch and sucrose metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416438 | UGP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424368 | UGP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416438 | Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 1 |
USD 396.00 |
|
LY424368 | Transient overexpression lysate of UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2 |
USD 396.00 |
|
PH300246 | UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_001001521) |
USD 2,055.00 |
|
PH308376 | UGP2 MS Standard C13 and N15-labeled recombinant protein (NP_006750) |
USD 2,055.00 |
|
TP300246 | Recombinant protein of human UDP-glucose pyrophosphorylase 2 (UGP2), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review