GATA2 (NM_032638) Human Recombinant Protein
CAT#: TP308554
Recombinant protein of human GATA binding protein 2 (GATA2), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208554 protein sequence
Red=Cloning site Green=Tags(s) MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSV YPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDG VKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTP KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116027 |
Locus ID | 2624 |
UniProt ID | P23769 |
Cytogenetics | 3q21.3 |
Refseq Size | 3383 |
Refseq ORF | 1440 |
Synonyms | DCML; IMD21; MONOMAC; NFE1B |
Summary | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403182 | GATA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428960 | GATA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403182 | Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 2 |
USD 325.00 |
|
LY428960 | Transient overexpression lysate of GATA binding protein 2 (GATA2), transcript variant 1 |
USD 325.00 |
|
PH308554 | GATA2 MS Standard C13 and N15-labeled recombinant protein (NP_116027) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review