C15orf38 (ARPIN) (NM_182616) Human Recombinant Protein
CAT#: TP308793
Recombinant protein of human chromosome 15 open reading frame 38 (C15orf38)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208793 protein sequence
Red=Cloning site Green=Tags(s) MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIH RRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLVNKPELLALTESLTPDHTVAF WMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTVTKCNFTGDGKTGASWTDNIMAQKCSKGAAA EIREQGDGAEDEEWDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872422 |
Locus ID | 348110 |
UniProt ID | Q7Z6K5 |
Cytogenetics | 15q26.1 |
Refseq Size | 6114 |
Refseq ORF | 678 |
Synonyms | C15orf38 |
Summary | Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405459 | ARPIN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405459 | Transient overexpression lysate of chromosome 15 open reading frame 38 (C15orf38) |
USD 325.00 |
|
PH308793 | C15orf38 MS Standard C13 and N15-labeled recombinant protein (NP_872422) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review