IKIP (IKBIP) (NM_153687) Human Recombinant Protein
CAT#: TP308952
Recombinant protein of human IKK interacting protein (IKIP), transcript variant 1
View other "IKBIP" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208952 protein sequence
Red=Cloning site Green=Tags(s) MSEVKSRKKSGPKGAPAAEPGKRSEGGKTPVARSSGGGGWADPRTCLSLLSLGTCLGLAWFVFQQSEKFA KVENQYQLLKLETNEFQQLQSKISLISEKLESTESILQEATSSMSLMTQFEQEVSNLQDIMHDIQNNEEV LTQRMQSLNEKFQNITDFWKRSLEEMNINTDIFKSEAKHIHSQVTVQINSAEQEIKLLTERLKDLEDSTL RNIRTVKRQEEEDLLRVEEQLGSDTKAIEKLEEEQHALFARDEDLTNKLSDYEPKVEECKTHLPTIESAI HSVLRVSQDLIETEKKMEDLTMQMFNMEDDMLKAVSEIMEMQKTLEGIQYDNSILKMQNELDILKEKVHD FIAYSSTGEKGTLKEYNIENKGIGGDF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_710154 |
Locus ID | 121457 |
UniProt ID | Q70UQ0 |
Cytogenetics | 12q23.1 |
Refseq Size | 3175 |
Refseq ORF | 1131 |
Synonyms | IKIP |
Summary | Target of p53/TP53 with pro-apoptotic function.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403519 | IKBIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404483 | IKBIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430890 | IKBIP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403519 | Transient overexpression lysate of IKBKB interacting protein (IKBIP), transcript variant 1 |
USD 396.00 |
|
LY404483 | Transient overexpression lysate of IKBKB interacting protein (IKBIP), transcript variant 2 |
USD 396.00 |
|
LY430890 | Transient overexpression lysate of IKBKB interacting protein (IKBIP), transcript variant 2 |
USD 396.00 |
|
PH308952 | IKBIP MS Standard C13 and N15-labeled recombinant protein (NP_710154) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review