GSTO2 (NM_183239) Human Recombinant Protein
CAT#: TP308961
Recombinant protein of human glutathione S-transferase omega 2 (GSTO2)
View other "GSTO2" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208961 protein sequence
Red=Cloning site Green=Tags(s) MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFG HIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGREC TNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWD PTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_899062 |
Locus ID | 119391 |
UniProt ID | Q9H4Y5 |
Cytogenetics | 10q25.1 |
Refseq Size | 1546 |
Refseq ORF | 729 |
Synonyms | bA127L20.1; GSTO 2-2 |
Summary | The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405234 | GSTO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434025 | GSTO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405234 | Transient overexpression lysate of glutathione S-transferase omega 2 (GSTO2) |
USD 396.00 |
|
LY434025 | Transient overexpression lysate of glutathione S-transferase omega 2 (GSTO2), transcript variant 4 |
USD 396.00 |
|
PH308961 | GSTO2 MS Standard C13 and N15-labeled recombinant protein (NP_899062) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review