FAM3B (NM_058186) Human Recombinant Protein

CAT#: TP309309

Recombinant protein of human family with sequence similarity 3, member B (FAM3B), transcript variant 1

Product Images

Coomassie blue staining of purified FAM3B protein (Cat# TP309309). The protein was produced from HEK293T cells transfected with FAM3B cDNA clone (Cat# RC209309) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209309 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCP
  SDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTK
  FIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHS
  DAKNNRYSGWPAEIQIEGCIPKERS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_478066
• Locus ID: 54097
• UniProt ID: P58499
• Cytogenetics: 21q22.3
• Refseq Size: 1384
• Refseq ORF: 705
• Synonyms: 2-21; C21orf11; C21orf76; ORF9; PANDER; PRED44
• Summary: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane