TRA16 (NR2C2AP) (NM_176880) Human Recombinant Protein

CAT#: TP309320

Recombinant protein of human nuclear receptor 2C2-associated protein (NR2C2AP)

Product Images

Coomassie blue staining of purified NR2C2AP protein (Cat# TP309320). The protein was produced from HEK293T cells transfected with NR2C2AP cDNA clone (Cat# RC209320) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209320 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTHSLVCPETVSRVSSVLNRNTRQFGKKHLFDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGF
  SSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDATDFFGRVVIYHLRVLGEKV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_795361
• Locus ID: 126382
• UniProt ID: Q86WQ0
• Cytogenetics: 19p13.11
• Refseq Size: 1322
• Refseq ORF: 417
• Synonyms: TRA16
• Summary: May act as a repressor of NR2C2-mediated transactivation by suppressing the binding between NR2C2/TR4 and the TR4-response element in target genes.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome