RHOJ (NM_020663) Human Recombinant Protein
CAT#: TP309395
Recombinant protein of human ras homolog gene family, member J (RHOJ)
View other "RHOJ" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209395 protein sequence
Red=Cloning site Green=Tags(s) MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHL LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDD PKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSC CSII myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065714 |
Locus ID | 57381 |
UniProt ID | Q9H4E5, A0A024R692, Q7Z513 |
Cytogenetics | 14q23.2 |
Refseq Size | 3619 |
Refseq ORF | 642 |
Synonyms | ARHJ; RASL7B; TC10B; TCL |
Summary | This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412401 | RHOJ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412401 | Transient overexpression lysate of ras homolog gene family, member J (RHOJ) |
USD 396.00 |
|
PH309395 | RHOJ MS Standard C13 and N15-labeled recombinant protein (NP_065714) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review