PXMP2 (NM_018663) Human Recombinant Protein

CAT#: TP309935

Recombinant protein of human peroxisomal membrane protein 2, 22kDa (PXMP2)

Product Images

Coomassie blue staining of purified PXMP2 protein (Cat# TP309935). The protein was produced from HEK293T cells transfected with PXMP2 cDNA clone (Cat# RC209935) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209935 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVG
  GPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAF
  AAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061133
• Locus ID: 5827
• UniProt ID: Q9NR77
• Cytogenetics: 12q24.33
• Refseq Size: 977
• Refseq ORF: 585
• Synonyms: MPV17L3; PMP22
• Summary: Seems to be involved in pore-forming activity and may contribute to the unspecific permeability of the peroxisomal membrane.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane