PDE6H (NM_006205) Human Recombinant Protein
CAT#: TP310215
Recombinant protein of human phosphodiesterase 6H, cGMP-specific, cone, gamma (PDE6H)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210215 protein sequence
Red=Cloning site Green=Tags(s) MSDNTTLPAPASNQGPTTPRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFS HLELHELAQFGII myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006196 |
Locus ID | 5149 |
UniProt ID | Q13956 |
Cytogenetics | 12p12.3 |
Refseq Size | 763 |
Refseq ORF | 249 |
Synonyms | ACHM6; RCD3 |
Summary | This gene encodes the inhibitory (or gamma) subunit of the cone-specific cGMP phosphodiesterase, which is a tetramer composed of two catalytic chains (alpha and beta), and two inhibitory chains (gamma). It is specifically expressed in the retina, and is involved in the transmission and amplification of the visual signal. Mutations in this gene are associated with retinal cone dystrophy type 3A (RCD3A). [provided by RefSeq, Mar 2010] |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416802 | PDE6H HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY416802 | Transient overexpression lysate of phosphodiesterase 6H, cGMP-specific, cone, gamma (PDE6H) |
USD 325.00 |
|
PH310215 | PDE6H MS Standard C13 and N15-labeled recombinant protein (NP_006196) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review