DNAJC15 (NM_013238) Human Recombinant Protein
CAT#: TP310567
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210567 protein sequence
Red=Cloning site Green=Tags(s) MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITE TAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEA KDLLETTTKH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037370 |
Locus ID | 29103 |
UniProt ID | Q9Y5T4 |
Cytogenetics | 13q14.11 |
Refseq Size | 2792 |
Refseq ORF | 450 |
Synonyms | DNAJD1; HSD18; MCJ |
Summary | Negative regulator of the mitochondrial respiratory chain. Prevents mitochondrial hyperpolarization state and restricts mitochondrial generation of ATP (By similarity). Acts as an import component of the TIM23 translocase complex. Stimulates the ATPase activity of HSPA9.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402228 | DNAJC15 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402228 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 15 (DNAJC15) |
USD 325.00 |
|
PH310567 | DNAJC15 MS Standard C13 and N15-labeled recombinant protein (NP_037370) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review