SNX11 (NM_013323) Human Recombinant Protein
CAT#: TP310611
Recombinant protein of human sorting nexin 11 (SNX11), transcript variant 2
View other "SNX11" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210611 protein sequence
Red=Cloning site Green=Tags(s) MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQL QRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQ GRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPV VDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037455 |
Locus ID | 29916 |
UniProt ID | Q9Y5W9 |
Cytogenetics | 17q21.32 |
Refseq Size | 2315 |
Refseq ORF | 810 |
Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407675 | SNX11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC415626 | SNX11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY407675 | Transient overexpression lysate of sorting nexin 11 (SNX11), transcript variant 1 |
USD 396.00 |
|
LY415626 | Transient overexpression lysate of sorting nexin 11 (SNX11), transcript variant 2 |
USD 396.00 |
|
PH300906 | SNX11 MS Standard C13 and N15-labeled recombinant protein (NP_689450) |
USD 2,055.00 |
|
PH310611 | SNX11 MS Standard C13 and N15-labeled recombinant protein (NP_037455) |
USD 2,055.00 |
|
TP300906 | Recombinant protein of human sorting nexin 11 (SNX11), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review