Cholecystokinin (CCK) (NM_000729) Human Recombinant Protein

CAT#: TP310694

Purified recombinant protein of Human cholecystokinin (CCK), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein CCK was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210694 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQAR
  KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
  
  myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 12.7 kDa
• Concentration: >50 ug/mL as determined by microplate Bradford method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000720
• Locus ID: 885
• UniProt ID: P06307, Q6FG82
• Cytogenetics: 3p22.1
• Refseq Size: 1511
• Refseq ORF: 345
• Summary: This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome, Secreted Protein