Cholecystokinin (CCK) (NM_000729) Human Recombinant Protein

CAT#: TP310694

Purified recombinant protein of Human cholecystokinin (CCK), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 867.00

2 Weeks*

Size
    • 20 ug

Product Images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC210694 protein sequence
Red=Cloning site Green=Tags(s)

MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQAR
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

myc-FLAG tag
Tag Myc-DDK
Predicted MW 12.7 kDa
Concentration >50 ug/mL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol
Storage Store at -80°C after receiving vials.
Stability Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_000720
Locus ID 885
UniProt ID P06307, Q6FG82
Cytogenetics 3p22.1
Refseq Size 1511
Refseq ORF 345
Summary This gene encodes a member of the gastrin/cholecystokinin family of proteins. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake. A sulfated form of cholecystokinin-8 may modulate neuronal activity in the brain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome, Secreted Protein

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.