NECAP1 (NM_015509) Human Recombinant Protein
CAT#: TP311100
Recombinant protein of human NECAP endocytosis associated 1 (NECAP1), transcript variant 1
View other "NECAP1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211100 protein sequence
Red=Cloning site Green=Tags(s) MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFA QAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKES QEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHV TPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056324 |
Locus ID | 25977 |
UniProt ID | Q8NC96 |
Cytogenetics | 12p13.31 |
Refseq Size | 2600 |
Refseq ORF | 825 |
Synonyms | DEE21; EIEE21 |
Summary | This gene encodes a protein containing two characteristic WXXF motifs. The encoded protein localizes to clathrin-coated vesicles, where it binds components of the adapter protein complexes and aids in endocytosis. Loss of function of this gene results in early infantile epileptic encephalopathy-21. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414502 | NECAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414502 | Transient overexpression lysate of NECAP endocytosis associated 1 (NECAP1), transcript variant 1 |
USD 396.00 |
|
PH311100 | NECAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056324) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review