CAMK2N2 (NM_033259) Human Recombinant Protein

CAT#: TP311256

Recombinant protein of human calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2)

Product Images

Coomassie blue staining of purified CAMK2N2 protein (Cat# TP311256). The protein was produced from HEK293T cells transfected with CAMK2N2 cDNA clone (Cat# RC211256) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211256 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG
  MGEKPPSGV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_150284
• Locus ID: 94032
• UniProt ID: Q96S95
• Cytogenetics: 3q27.1
• Refseq Size: 1360
• Refseq ORF: 237
• Synonyms: CAM-KIIN; CAMKIIN
• Summary: This gene encodes a protein that is highly similar to the rat CaM-KII inhibitory protein, an inhibitor of calcium/calmodulin-dependent protein kinase II (CAMKII). CAMKII regulates numerous physiological functions, including neuronal synaptic plasticity through the phosphorylation of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid-type glutamate (AMPA) receptors. Studies of the similar protein in rat suggest that this protein may function as a negative regulator of CaM-KII and may act to inhibit the phosphorylation of AMPA receptors. [provided by RefSeq, Jul 2008]