CDCP2 (NM_201546) Human Recombinant Protein

CAT#: TP312119

Recombinant protein of human CUB domain containing protein 2 (CDCP2)

Product Images

Coomassie blue staining of purified CDCP2 protein (Cat# TP312119). The protein was produced from HEK293T cells transfected with CDCP2 cDNA clone (Cat# RC212119) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212119 representing NM_201546
  Red=Cloning site Green=Tags(s)
  
  MLAEWGACLLLAVALLGPGLQAQAMEGVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSSVLL
  TFHAFDLEYHDTCSFDFLEIYNGASPDKGNLLGRFCGKVPPPPFTSSWHVMSVIFHSDKHVASHGFSAGY
  QKDVCGGVLTGLSGVLTSPEYPNNYPNSMECHWVIRAAGPAHVKLVFVDFQVEGNEECTYDYVAVLGGPG
  PTRGHHYCGSTRPPTLVSLGHELQVVFKSDFNIGGRGFKAYYFSGECQEVYMAMRGNFSSPQYPSSYPNN
  IRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQ
  LLLLLHTDRSTTRRGFSVAYIGGQLGCGSGSTEGEGEALQPQSLQSPSSIPPVCPAPPMNGLLQLLLHWL
  HPCPLSGPLRLDGTAPACFHYCRASFPSF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 48.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_963840
• Locus ID: 200008
• UniProt ID: Q5VXM1
• Cytogenetics: 1p32.3
• Refseq Size: 2723
• Refseq ORF: 1347
• Protein Families: Druggable Genome