GNG8 (NM_033258) Human Recombinant Protein

CAT#: TP312301

Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 8 (GNG8)

Product Images

Coomassie blue staining of purified GNG8 protein (Cat# TP312301). The protein was produced from HEK293T cells transfected with GNG8 cDNA clone (Cat# RC212301) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212301 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSNNMAKIAEARKTVEQLKLEVNIDRMKVSQAAAELLAFCETHAKDDPLVTPVPAAENPFRDKRLFCVLL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 7.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_150283
• Locus ID: 94235
• UniProt ID: Q9UK08
• Cytogenetics: 19q13.32
• Refseq Size: 213
• Refseq ORF: 212
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway