PRR3 (NM_025263) Human Recombinant Protein
CAT#: TP312403
Recombinant protein of human proline rich 3 (PRR3), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212403 protein sequence
Red=Cloning site Green=Tags(s) MPKRKKQNHHQPPTQQQPPLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHRGPPGSRGPLI PPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIK NTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDLCAFYHPGVNGPPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079539 |
Locus ID | 80742 |
UniProt ID | P79522, Q96QB9 |
Cytogenetics | 6p21.33 |
Refseq Size | 3404 |
Refseq ORF | 564 |
Synonyms | CAT56 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410821 | PRR3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421446 | PRR3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425870 | PRR3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410821 | Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 1 |
USD 325.00 |
|
LY421446 | Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 2 |
USD 325.00 |
|
LY425870 | Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 2 |
USD 325.00 |
|
PH312403 | PRR3 MS Standard C13 and N15-labeled recombinant protein (NP_079539) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review