CEACAM20 (NM_001102597) Human Recombinant Protein

CAT#: TP313248

Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 20 (CEACAM20), transcript variant 5L

Product Images

Coomassie blue staining of purified CEACAM20 protein (Cat# TP313248). The protein was produced from HEK293T cells transfected with CEACAM20 cDNA clone (Cat# RC213248) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213248 representing NM_001102597
  Red=Cloning site Green=Tags(s)
  
  MGPADSWGHHWMGILLSASLCTVWSPPAAAQLTLNANPLDATQSEDVVLPVFGTPRTPQIHGRSRELAKP
  SIAVSPGTAIEQKDMVTFYCTTKDVNITIHWVSNNLSVVFHERMQLSKDGKILTILIVQREDSGTYQCEA
  RDALLSQRSDPIFLDVKYGPDPVEIKLESGVASGEVVEVMEGSSMTFLAETKSHPPCAYTWFLLDSILSH
  TTRTFTIHAVSREHEGLYRCLVSNSATHLSSLGTLKVRVLETLTMPQVVPSSLNLVENARSVDLTCQTVN
  QSVNVQWFLSGQPLLPSEHLQLSADNRTLIIHGLQRNDTGPYACEVWNWGSRARSEPLELTINYGPDQVH
  ITRESASEMISTIEAELNSSLTLQCWAESKPGAEYRWTLEHSTGEHLGEQLIIRALTWEHDGIYNCTASN
  SLTGLARSTSVLVKVVGPQSSSLSSGAIAGIVIGILAVIAVASELGYFLYIRNARRPSRKTTEDPSHETS
  QPIPKEEHPTEPSSESLSPEYCNISQLQGRIRVELMQPPDLPEETYETKLPSASRRGNSFSPWKPPPKPL
  MPPLRLVSTVPKNMESIYEELVNPEPNTYIQINPSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 65.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001096067
• Locus ID: 125931
• UniProt ID: Q6UY09
• Cytogenetics: 19q13.31
• Refseq Size: 1809
• Refseq ORF: 1788
• Synonyms: UNQ9366
• Summary: Together with the tyrosine-protein kinase SYK, enhances production of the cytokine CXCL8/IL-8 via the NFKB pathway and may thus have a role in the intestinal immune response.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane