LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein
CAT#: TP313256
Recombinant protein of human chemokine (C-C motif) ligand 3-like 1 (CCL3L1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213256 protein sequence
Red=Cloning site Green=Tags(s) MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRG RQVCADPSEEWVQKYVSDLELSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066286 |
Locus ID | 6349 |
UniProt ID | P16619 |
Cytogenetics | 17q21.1 |
Refseq Size | 805 |
Refseq ORF | 279 |
Synonyms | 464.2; D17S1718; G0S19-2; LD78; LD78-beta(1-70); LD78BETA; MIP1AP; SCYA3L; SCYA3L1 |
Summary | This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this gene binds to several chemokine receptors, including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals, where most individuals have one to six copies, and a minority of individuals have zero or more than six copies. There are conflicting reports about copy number variation of this gene and its correlation to disease susceptibility. This record represents one of two copies that are present on the ALT_REF_LOCI_2 alternate haplotype of the GRCh38 human reference genome assembly. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412133 | CCL3L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412133 | Transient overexpression lysate of chemokine (C-C motif) ligand 3-like 1 (CCL3L1) |
USD 325.00 |
|
PH313256 | CCL3L1 MS Standard C13 and N15-labeled recombinant protein (NP_066286) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review