HPR (NM_020995) Human Recombinant Protein
CAT#: TP318300
Recombinant protein of human haptoglobin-related protein (HPR)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218300 representing NM_020995
Red=Cloning site Green=Tags(s) MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLN DKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLL TTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLP SKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHT FCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066275 |
Locus ID | 3250 |
UniProt ID | P00739 |
Cytogenetics | 16q22.2 |
Refseq Size | 1245 |
Refseq ORF | 1044 |
Synonyms | A-259H10.2; HP |
Summary | This gene encodes a haptoglobin-related protein that binds hemoglobin as efficiently as haptoglobin. Unlike haptoglobin, plasma concentration of this protein is unaffected in patients with sickle cell anemia and extensive intravascular hemolysis, suggesting a difference in binding between haptoglobin-hemoglobin and haptoglobin-related protein-hemoglobin complexes to CD163, the hemoglobin scavenger receptor. This protein may also be a clinically important predictor of recurrence of breast cancer. [provided by RefSeq, Oct 2011] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412112 | HPR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412112 | Transient overexpression lysate of haptoglobin-related protein (HPR) |
USD 325.00 |
|
PH318300 | HPR MS Standard C13 and N15-labeled recombinant protein (NP_066275) |
USD 2,055.00 |
|
TP750140 | Purified recombinant protein of Human haptoglobin-related protein (HPR),Leu20-End, with N-terminal His tag, expressed in E. coli, 50ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review