Tryptophanyl tRNA synthetase (WARS) (NM_004184) Human Recombinant Protein
CAT#: TP720622
Purified recombinant protein of Human tryptophanyl-tRNA synthetase (WARS), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVS LKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSS KIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLI PFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKT
|
Tag | N-His |
Predicted MW | 55 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, 100mM NaCl, 1mM DTT, 10% Glycerol, pH8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004175 |
Locus ID | 7453 |
UniProt ID | P23381, A0A024R6K8 |
Cytogenetics | 14q32.2 |
Refseq Size | 2884 |
Refseq ORF | 1413 |
Synonyms | GAMMA-2; HMN9; IFI53; IFP53 |
Summary | 'Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome |
Protein Pathways | Aminoacyl-tRNA biosynthesis, Tryptophan metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401346 | WARS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC406568 | WARS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY401346 | Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 1 |
USD 325.00 |
|
LY406568 | Transient overexpression lysate of tryptophanyl-tRNA synthetase (WARS), transcript variant 2 |
USD 495.00 |
|
PH313605 | WARS MS Standard C13 and N15-labeled recombinant protein (NP_776049) |
USD 2,055.00 |
|
TP313605 | Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 2 |
USD 788.00 |
|
TP760112 | Recombinant protein of human tryptophanyl-tRNA synthetase (WARS), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review