MINPP1 (NM_004897) Human Recombinant Protein
CAT#: TP720678
Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLYHCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDELVDHHHHHH
|
Tag | C-His |
Predicted MW | 53.14 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004888 |
Locus ID | 9562 |
UniProt ID | Q9UNW1 |
Cytogenetics | 10q23.2 |
Refseq Size | 2412 |
Refseq ORF | 1461 |
Synonyms | HIPER1; MINPP2; MIPP |
Summary | This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417667 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432866 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417667 | Transient overexpression lysate of multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1) |
USD 325.00 |
|
LY432866 | Transient overexpression lysate of multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2 |
USD 325.00 |
|
PH307581 | MINPP1 MS Standard C13 and N15-labeled recombinant protein (NP_004888) |
USD 2,055.00 |
|
TP307581 | Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1) |
USD 823.00 |
|
TP329866 | Purified recombinant protein of Homo sapiens multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2. |
USD 748.00 |
|
TP710176 | Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review