UBE2B (NM_003337) Human Recombinant Protein
CAT#: TP720719
Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDSLDHHHHHH
|
Tag | C-His |
Predicted MW | 18.3 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 25mM Tris, pH 7.5 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003328 |
Locus ID | 7320 |
UniProt ID | P63146 |
Cytogenetics | 5q31.1 |
Refseq Size | 2631 |
Refseq ORF | 456 |
Synonyms | E2-17kDa; HHR6B; HR6B; RAD6B; UBC2 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418755 | UBE2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418755 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B) |
USD 325.00 |
|
PH303306 | UBE2B MS Standard C13 and N15-labeled recombinant protein (NP_003328) |
USD 2,055.00 |
|
TP303306 | Recombinant protein of human ubiquitin-conjugating enzyme E2B (RAD6 homolog) (UBE2B) |
USD 823.00 |
|
TP720915 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review