UBE2B (NM_003337) Human Recombinant Protein

CAT#: TP720719

Purified recombinant protein of Human ubiquitin-conjugating enzyme E2B (UBE2B)


  View other "UBE2B" proteins (5)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "UBE2B"

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDSLDHHHHHH
Tag C-His
Predicted MW 18.3 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of 25mM Tris, pH 7.5
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_003328
Locus ID 7320
UniProt ID P63146
Cytogenetics 5q31.1
Refseq Size 2631
Refseq ORF 456
Synonyms E2-17kDa; HHR6B; HR6B; RAD6B; UBC2
Summary The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.