Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein
CAT#: TP720758
Purified recombinant protein of Human pancreatic lipase-related protein 2 (PNLIPRP2)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPCLDHHHHHH
|
Tag | C-His |
Predicted MW | 51.16 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,10%Glycerol,pH7.5 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005387 |
Locus ID | 5408 |
Cytogenetics | 10q25.3 |
Refseq Size | 1486 |
Refseq ORF | 1410 |
Synonyms | PLRP2 |
Summary | 'This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele. [provided by RefSeq, Aug 2015]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Glycerolipid metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401656 | PNLIPRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY401656 | Transient overexpression lysate of pancreatic lipase-related protein 2 (PNLIPRP2) |
USD 495.00 |
|
PH321745 | PNLIPRP2 MS Standard C13 and N15-labeled recombinant protein (NP_005387) |
USD 2,055.00 |
|
TP321745 | Recombinant protein of human pancreatic lipase-related protein 2 (PNLIPRP2) |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review