Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein

CAT#: TP720758

Purified recombinant protein of Human pancreatic lipase-related protein 2 (PNLIPRP2)


  View other "PNLIPRP2" proteins (4)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "PNLIPRP2"

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPCLDHHHHHH
Tag C-His
Predicted MW 51.16 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of 20mM TrisHCl,150mM NaCl,1mM GaCl2,10%Glycerol,pH7.5
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_005387
Locus ID 5408
Cytogenetics 10q25.3
Refseq Size 1486
Refseq ORF 1410
Synonyms PLRP2
Summary 'This gene encodes a lipase that hydrolyzes galactolipids, the main components of plant membrane lipids. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the non-coding allele. [provided by RefSeq, Aug 2015]'
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Glycerolipid metabolism, Metabolic pathways

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.