CD99L2 (NM_031462) Human Recombinant Protein
CAT#: TP720762
Purified recombinant protein of Human CD99 molecule-like 2 (CD99L2), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
DFDDFNLEDAVKETSSVKQPWDHTTTTTTNRPGTTRAPAKPPGSGLDLADALDDQDDGRRKPGIGGRERWNHVTTTTKRPVTTRAPANTLGNDFDLADALDDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEPGTIAVDHHHHHH
|
Tag | C-His |
Predicted MW | 18.4 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_113650 |
Locus ID | 83692 |
UniProt ID | Q8TCZ2, A0A024RC16 |
Cytogenetics | Xq28 |
Refseq Size | 3736 |
Refseq ORF | 786 |
Synonyms | CD99B; MIC2L1 |
Summary | This gene encodes a cell-surface protein that is similar to CD99. A similar protein in mouse functions as an adhesion molecule during leukocyte extravasation. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410504 | CD99L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432656 | CD99L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410504 | Transient overexpression lysate of CD99 molecule-like 2 (CD99L2), transcript variant 1 |
USD 325.00 |
|
LY432656 | Transient overexpression lysate of CD99 molecule-like 2 (CD99L2), transcript variant 4 |
USD 325.00 |
|
PH307079 | CD99L2 MS Standard C13 and N15-labeled recombinant protein (NP_113650) |
USD 2,055.00 |
|
TP307079 | Recombinant protein of human CD99 molecule-like 2 (CD99L2), transcript variant 1 |
USD 823.00 |
|
TP329656 | Purified recombinant protein of Homo sapiens CD99 molecule-like 2 (CD99L2), transcript variant 4. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review