XPNPEP3 (NM_022098) Human Recombinant Protein

CAT#: TP720858

Purified recombinant protein of Human X-prolyl aminopeptidase (aminopeptidase P) 3, putative (XPNPEP3), nuclear gene encoding mitochondrial protein, transcript variant 1


  View other "XPNPEP3" proteins (4)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "XPNPEP3"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGSSHHHHHHSSGLVPRGSHMPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRG
Tag N, C-His
Predicted MW 60.2 kDa
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as a 0.2 µM filtered solution of 25mM Tris, 1mM DTT, pH 7.3
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 3 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_071381
Locus ID 63929
UniProt ID Q9NQH7
Cytogenetics 22q13.2
Refseq Size 8027
Refseq ORF 1521
Synonyms APP3; ICP55; NPHPL1
Summary The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known. [provided by RefSeq, Mar 2011]
Protein Families Druggable Genome, Protease

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.