XPNPEP3 (NM_022098) Human Recombinant Protein
CAT#: TP720858
Purified recombinant protein of Human X-prolyl aminopeptidase (aminopeptidase P) 3, putative (XPNPEP3), nuclear gene encoding mitochondrial protein, transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSHMPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRG
|
Tag | N, C-His |
Predicted MW | 60.2 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 25mM Tris, 1mM DTT, pH 7.3 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_071381 |
Locus ID | 63929 |
UniProt ID | Q9NQH7 |
Cytogenetics | 22q13.2 |
Refseq Size | 8027 |
Refseq ORF | 1521 |
Synonyms | APP3; ICP55; NPHPL1 |
Summary | The protein encoded by this gene belongs to the family of X-pro-aminopeptidases that utilize a metal cofactor, and remove the N-terminal amino acid from peptides with a proline residue in the penultimate position. This protein has been shown to localize to the mitochondria of renal cells, and have a role in ciliary function. Mutations in this gene are associated with nephronophthisis-like nephropathy-1. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene, however, expression of some of these isoforms in vivo is not known. [provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402903 | XPNPEP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402903 | Transient overexpression lysate of X-prolyl aminopeptidase (aminopeptidase P) 3, putative (XPNPEP3) |
USD 325.00 |
|
PH300888 | XPNPEP3 MS Standard C13 and N15-labeled recombinant protein (NP_071381) |
USD 2,055.00 |
|
TP300888 | Recombinant protein of human X-prolyl aminopeptidase (aminopeptidase P) 3, putative (XPNPEP3) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review