SULT1B1 (NM_014465) Human Recombinant Protein

CAT#: TP720936

Purified recombinant protein of Human sulfotransferase family, cytosolic, 1B, member 1 (SULT1B1)

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MNHKVHHHHHHMLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKRKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHL
• Tag: N-His
• Predicted MW: 36.3 kDa
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Supplied as a 0.2 µM filtered solution of 20mM Tris, 0.1M NaCl, pH 8.0
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 3 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055280
• Locus ID: 27284
• UniProt ID: O43704
• Cytogenetics: 4q13.3
• Refseq Size: 1320
• Refseq ORF: 888
• Synonyms: ST1B1; ST1B2; SULT1B2
• Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes. [provided by RefSeq, Jul 2008]