Lymphotactin (XCL1) (NM_002995) Human Recombinant Protein
CAT#: TP721076
Purified recombinant protein of Human chemokine (C motif) ligand 1 (XCL1)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
|
Tag | C-Fc/His |
Predicted MW | 40.4 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002986 |
Locus ID | 6375 |
UniProt ID | P47992 |
Cytogenetics | 1q24.2 |
Refseq Size | 1367 |
Refseq ORF | 342 |
Synonyms | ATAC; LPTN; LTN; SCM-1; SCM-1a; SCM1; SCM1A; SCYC1 |
Summary | 'This antimicrobial gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1. [provided by RefSeq, Sep 2014]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418965 | XCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418965 | Transient overexpression lysate of chemokine (C motif) ligand 1 (XCL1) |
USD 325.00 |
|
TP723277 | Purified recombinant protein of Human chemokine (C motif) ligand 1 (XCL1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review