LRRC25 (NM_145256) Human Recombinant Protein

CAT#: TP721232

Purified recombinant protein of Human leucine rich repeat containing 25 (LRRC25)

Specifications

Product Data

• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  LEPSCTVSSADVDWNAEFSATCLNFSGLSLSLPHNQSLRASNVILLDLSGNGLRELPVTFFAHLQKLEVLNVLRNPLSRVDGALAARCDLDLQADCNCALESWHDIRRDNCSGQKPLLCWDTTSSQHNLSAFLEVSCAPGLASATVDHHHHHH*
• Tag: C-His
• Predicted MW: 16.7 kDa
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized froma 0.2 µM filtered solution of 20mM PB,150mM NaCl,pH7.4
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660299
• Locus ID: 126364
• UniProt ID: Q8N386
• Cytogenetics: 19p13.11
• Refseq Size: 2430
• Refseq ORF: 915
• Synonyms: MAPA
• Summary: May be involved in the activation of cells of innate and acquired immunity. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane