Adipoq (NM_009605) Mouse Recombinant Protein

CAT#: TP723007

Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq).

Specifications

Product Data

• Species: Mouse
• Expression Host: Hi-5 insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
• Tag: N-His
• Predicted MW: 35 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0ug/mL.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_033735
• Locus ID: 11450
• UniProt ID: Q60994
• Cytogenetics: 16 13.96 cM
• Refseq Size: 1233
• Refseq ORF: 741
• Synonyms: 30kDa; Acdc; Acrp30; Ad; Adid; adipo; apM1; APN; GBP28