BAFF Receptor (TNFRSF13C) (NM_052945) Human Recombinant Protein

CAT#: TP723026

Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 13C (TNFRSF13C).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG
• Tag: Tag Free
• Predicted MW: 7.7 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 2.0-4.0 ug/mL in the presence of 1.0 ug/mL of human soluble BAFF.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443177
• Locus ID: 115650
• UniProt ID: Q96RJ3, Q5H8V1
• Cytogenetics: 22q13.2
• Refseq Size: 898
• Refseq ORF: 552
• Synonyms: BAFF-R; BAFFR; BROMIX; CD268; CVID4; prolixin
• Summary: B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Primary immunodeficiency