BMP3 (NM_001201) Human Recombinant Protein
CAT#: TP723041
Purified recombinant protein of Human bone morphogenetic protein 3 (BMP3).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
|
Tag | Tag Free |
Predicted MW | 13 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to inhibit BMP-2-induced alkaline phosphatase production by ATDC-5 cells. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001192 |
Locus ID | 651 |
UniProt ID | P12645 |
Cytogenetics | 4q21.21 |
Refseq Size | 1774 |
Refseq ORF | 1416 |
Synonyms | BMP-3A |
Summary | 'This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein suppresses osteoblast differentiation, and negatively regulates bone density, by modulating TGF-beta receptor availability to other ligands. [provided by RefSeq, Jul 2016]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400482 | BMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY400482 | Transient overexpression lysate of bone morphogenetic protein 3 (BMP3) |
USD 495.00 |
|
PH312801 | BMP3 MS Standard C13 and N15-labeled recombinant protein (NP_001192) |
USD 2,055.00 |
|
TP312801 | Recombinant protein of human bone morphogenetic protein 3 (BMP3) |
USD 788.00 |
|
TP761195 | Purified recombinant protein of Human bone morphogenetic protein 3 (BMP3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review