Cntf (NM_013166) Rat Recombinant Protein

CAT#: TP723057

Purified recombinant protein of Rat ciliary neurotrophic factor (Cntf).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
• Tag: Tag Free
• Predicted MW: 22.7 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to stimulate proliferation of human TF-1 cells using a concentration range of 25.0-35.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037298
• Locus ID: 25707
• UniProt ID: P20294
• Cytogenetics: 1q43
• Refseq Size: 1101
• Refseq ORF: 600
• Summary: a cytokine involved in neuronal degeneration and adipocyte gene expression [RGD, Feb 2006]