FGF5 (NM_004464) Human Recombinant Protein
CAT#: TP723099
Purified recombinant protein of Human fibroblast growth factor 5 (FGF5), transcript variant 2.
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG
|
Tag | Tag Free |
Predicted MW | 27.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF-receptors is less than or equal to 0.5 ng/ml, corresponding to a specific activity of > 2 x 10^6 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004455 |
Locus ID | 2250 |
UniProt ID | P12034, Q8NBG6 |
Cytogenetics | 4q21.21 |
Refseq Size | 5295 |
Refseq ORF | 369 |
Synonyms | HBGF-5; Smag-82; TCMGLY |
Summary | 'The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401420 | FGF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC409708 | FGF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY401420 | Transient overexpression lysate of fibroblast growth factor 5 (FGF5), transcript variant 1 |
USD 325.00 |
|
LY409708 | Transient overexpression lysate of fibroblast growth factor 5 (FGF5), transcript variant 2 |
USD 325.00 |
{0} Product Review(s)
Be the first one to submit a review