Fgf1 (NM_012846) Rat Recombinant Protein

CAT#: TP723106

Purified recombinant protein of Rat fibroblast growth factor 1 (Fgf1).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
• Tag: Tag Free
• Predicted MW: 15.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by a cell proliferation assay using balb/c 3T3 cells. The expected ED50 is less than or equal to 0.1 ng/ml, in the presence of 10 ug/ml heparin, corresponding to a specific activity of > 1 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036978
• Locus ID: 25317
• UniProt ID: P61149
• Cytogenetics: 18p11
• Refseq Size: 1216
• Refseq ORF: 465
• Synonyms: FGF-1; HBGF-1; HBGF1
• Summary: may play a role in neurite outgrowth; may regulate cell differentiation in the nervous system; may act in synergy with fibronectin to enhance neuronal cell adhesion [RGD, Feb 2006]