Fgf1 (NM_012846) Rat Recombinant Protein
CAT#: TP723106
Purified recombinant protein of Rat fibroblast growth factor 1 (Fgf1).
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
|
Tag | Tag Free |
Predicted MW | 15.9 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by a cell proliferation assay using balb/c 3T3 cells. The expected ED50 is less than or equal to 0.1 ng/ml, in the presence of 10 ug/ml heparin, corresponding to a specific activity of > 1 x 10^7 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036978 |
Locus ID | 25317 |
UniProt ID | P61149 |
Cytogenetics | 18p11 |
Refseq Size | 1216 |
Refseq ORF | 465 |
Synonyms | FGF-1; HBGF-1; HBGF1 |
Summary | may play a role in neurite outgrowth; may regulate cell differentiation in the nervous system; may act in synergy with fibronectin to enhance neuronal cell adhesion [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP501152 | Purified recombinant protein of Mouse fibroblast growth factor 1 (Fgf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP720034 | Recombinant protein of mouse fibroblast growth factor acidic |
USD 330.00 |
|
TP723105 | Purified recombinant protein of Mouse fibroblast growth factor 1 (Fgf1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review