GCP2 (CXCL6) (NM_002993) Human Recombinant Protein

CAT#: TP723126

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) (CXCL6).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
• Tag: Tag Free
• Predicted MW: 7.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to chemoattract human neutrophils using a concentration range of 10.0-50.0 ng/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002984
• Locus ID: 6372
• UniProt ID: P80162
• Cytogenetics: 4q13.3
• Refseq Size: 1677
• Refseq ORF: 342
• Synonyms: CKA-3; GCP-2; GCP2; SCYB6
• Summary: ''
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction