Csf3 (NM_009971) Mouse Recombinant Protein

CAT#: TP723128

Purified recombinant protein of Mouse colony stimulating factor 3 (granulocyte) (Csf3).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MVPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
• Tag: Tag Free
• Predicted MW: 19 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 was determined by the dose-dependent stimulation of the proliferation of murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of >2 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_034101
• Locus ID: 12985
• UniProt ID: P09920, Q0VB73
• Cytogenetics: 11 62.45 cM
• Refseq Size: 1363
• Refseq ORF: 624
• Synonyms: Csfg; G-CSF; MGI-IG
• Summary: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. [UniProtKB/Swiss-Prot Function]