BMP11 (GDF11) (NM_005811) Human Recombinant Protein
CAT#: TP723130
Purified recombinant protein of Human growth differentiation factor 11 (GDF11).
Product Images
Other products for "GDF11"
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
|
Tag | Tag Free |
Predicted MW | 25 kDa |
Concentration | Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1~1.0 mg/ml, and keep pH at acidic condition below 5.0; Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (e.g. 0.1% BSA) and store in working aliquots at -20°C to -80°C |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Sterile filtered through 0.2 µM filtered, Lyophilized with no additives |
Bioactivity | ED50 was determined by its ability to inhibit induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.08-0.10 ug/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005802 |
Locus ID | 10220 |
UniProt ID | O95390, A0A024RB20 |
Cytogenetics | 12q13.2 |
Refseq Size | 1662 |
Refseq ORF | 1221 |
Synonyms | BMP-11; BMP11 |
Summary | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.