BMP11 (GDF11) (NM_005811) Human Recombinant Protein

CAT#: TP723130

Purified recombinant protein of Human growth differentiation factor 11 (GDF11).

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
• Tag: Tag Free
• Predicted MW: 25 kDa
• Concentration: Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1~1.0 mg/ml, and keep pH at acidic condition below 5.0; Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (e.g. 0.1% BSA) and store in working aliquots at -20°C to -80°C
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Sterile filtered through 0.2 µM filtered, Lyophilized with no additives
• Bioactivity: ED50 was determined by its ability to inhibit induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 0.08-0.10 ug/ml.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005802
• Locus ID: 10220
• UniProt ID: O95390, A0A024RB20
• Cytogenetics: 12q13.2
• Refseq Size: 1662
• Refseq ORF: 1221
• Synonyms: BMP-11; BMP11
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, Secreted Protein