GDNF (NM_000514) Human Recombinant Protein
CAT#: TP723137
Purified recombinant protein of Human glial cell derived neurotrophic factor (GDNF), transcript variant 1.
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
|
Tag | Tag Free |
Predicted MW | 15 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 was determined by the proliferation of rat C6 cells is > 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000505 |
Locus ID | 2668 |
UniProt ID | P39905, A0A0S2Z3V2 |
Cytogenetics | 5p13.2 |
Refseq Size | 836 |
Refseq ORF | 633 |
Synonyms | ATF; ATF1; ATF2; HFB1-GDNF; HSCR3 |
Summary | 'This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Mutations in this gene may be associated with Hirschsprung disease and Tourette syndrome. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403701 | GDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC403702 | GDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424672 | GDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424999 | GDNF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403701 | Transient overexpression lysate of glial cell derived neurotrophic factor (GDNF), transcript variant 2 |
USD 396.00 |
|
LY403702 | Transient overexpression lysate of glial cell derived neurotrophic factor (GDNF), transcript variant 3 |
USD 396.00 |
|
LY424672 | Transient overexpression lysate of glial cell derived neurotrophic factor (GDNF), transcript variant 1 |
USD 396.00 |
|
LY424999 | Transient overexpression lysate of glial cell derived neurotrophic factor (GDNF), transcript variant 1 |
USD 396.00 |
|
TP720617 | Purified recombinant protein of Human glial cell derived neurotrophic factor (GDNF), transcript variant 1 |
USD 330.00 |
|
TP760516 | Purified recombinant protein of Human glial cell derived neurotrophic factor (GDNF), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
|
TP761700 | Purified recombinant protein of Human glial cell derived neurotrophic factor (GDNF), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review