Csf2 (NM_009969) Mouse Recombinant Protein
CAT#: TP723143
Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2).
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
|
Tag | Tag Free |
Predicted MW | 14.2 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_034099 |
Locus ID | 12981 |
UniProt ID | P01587, Q5SX78 |
Cytogenetics | 11 32.13 cM |
Refseq Size | 1033 |
Refseq ORF | 423 |
Synonyms | CSF; Csfgm; Gm-CSf; GMCSF; MGI-IGM |
Summary | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP522594 | Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
USD 748.00 |
|
TP723144 | Purified recombinant protein of Rat GM-CSF |
USD 240.00 |
|
TP723753 | Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2) |
USD 205.00 |
|
TP723880 | Purified recombinant protein of Rat GM-CSF (?) |
USD 205.00 |
|
TP750017 | Recombinant protein of Mus musculus colony stimulating factor 2 (granulocyte-macrophage) (Csf2) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review