Csf2 (NM_009969) Mouse Recombinant Protein

CAT#: TP723143

Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
• Tag: Tag Free
• Predicted MW: 14.2 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is less than or equal to 0.05 ng/ml, corresponding to a specific activity of > 2 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_034099
• Locus ID: 12981
• UniProt ID: P01587, Q5SX78
• Cytogenetics: 11 32.13 cM
• Refseq Size: 1033
• Refseq ORF: 423
• Synonyms: CSF; Csfgm; Gm-CSf; GMCSF; MGI-IGM
• Summary: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. [UniProtKB/Swiss-Prot Function]