NRG1 (NM_013962) Human Recombinant Protein

CAT#: TP723155

Purified recombinant protein of Human neuregulin 1 (NRG1), transcript variant GGF2.

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
• Tag: Tag Free
• Predicted MW: 7.5 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by the dose-dependent stimulation of the proliferation of human MCF-7 cells is less than or equal to 0.5 ng/ml, corresponding to a specific activity of >2 x 10^6 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001153467
• Locus ID: 3084
• UniProt ID: Q02297, A0A494C1F8, A6MW56, E3SFM9
• Cytogenetics: 8p12
• Refseq Size: 1986
• Refseq ORF: 1266
• Synonyms: ARIA; GGF; GGF2; HGL; HRG; HRG1; HRGA; MST131; MSTP131; NDF; NRG1-IT2; SMDF
• Summary: 'The protein encoded by this gene is a membrane glycoprotein that mediates cell-cell signaling and plays a critical role in the growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced from this gene through alternative promoter usage and splicing. These isoforms are expressed in a tissue-specific manner and differ significantly in their structure, and are classified as types I, II, III, IV, V and VI. Dysregulation of this gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Apr 2016]'
• Protein Families: Druggable Genome, Secreted Protein, Transcription Factors, Transmembrane
• Protein Pathways: ErbB signaling pathway