IFNW1 (NM_002177) Human Recombinant Protein

CAT#: TP723168

Purified recombinant protein of Human interferon, omega 1 (IFNW1).

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
• Tag: Tag Free
• Predicted MW: 19.9 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: ED50 was determined by a cytotoxicity assay using Human TF-1 cells is < 0.01 ng/ml, corresponding to a specific activity of > 1 x 10^8 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002168
• Locus ID: 3467
• UniProt ID: P05000
• Cytogenetics: 9p21.3
• Refseq Size: 1514
• Refseq ORF: 585
• Synonyms: IFN-omega 1, interferon omega-1; interferon, omega 1; interferon omega-1; OTTHUMP00000021133
• Summary: 'The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout the genome. [provided by RefSeq, Nov 2015]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, RIG-I-like receptor signaling pathway