IGFBP1 (NM_000596) Human Recombinant Protein
CAT#: TP723169
Purified recombinant protein of Human insulin-like growth factor binding protein 1 (IGFBP1).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
|
Tag | Tag Free |
Predicted MW | 25.4 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | ED50 was determined by its ability to inhibit IGF-I induced proliferation of MCF-7 is less than or equal to 0.5 ug/mL in the presence of 6 ng/ml of human IGF-I. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000587 |
Locus ID | 3484 |
UniProt ID | P08833 |
Cytogenetics | 7p12.3 |
Refseq Size | 1660 |
Refseq ORF | 777 |
Synonyms | AFBP; hIGFBP-1; IBP1; IGF-BP25; PP12 |
Summary | 'This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients. [provided by RefSeq, Aug 2017]' |
Protein Families | Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400199 | IGFBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400199 | Transient overexpression lysate of insulin-like growth factor binding protein 1 (IGFBP1) |
USD 325.00 |
|
PH309268 | IGFBP1 MS Standard C13 and N15-labeled recombinant protein (NP_000587) |
USD 2,055.00 |
|
TP309268 | Recombinant protein of human insulin-like growth factor binding protein 1 (IGFBP1) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review