IGFBP6 (NM_002178) Human Recombinant Protein
CAT#: TP723174
Purified recombinant protein of Human insulin-like growth factor binding protein 6 (IGFBP6).
Specifications
Product Data | |
Species | Human |
Expression Host | Hi-5 insect |
Expression cDNA Clone or AA Sequence |
RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
|
Tag | Tag Free |
Predicted MW | 22.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to inhibit IGF-II induced proliferation of human MCF-7 cells. The expected ED50 for this effect is 0.1 - 0.4ug/mL. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002169 |
Locus ID | 3489 |
UniProt ID | P24592 |
Cytogenetics | 12q13.13 |
Refseq Size | 980 |
Refseq ORF | 720 |
Synonyms | IBP6 |
Summary | '' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400790 | IGFBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400790 | Transient overexpression lysate of insulin-like growth factor binding protein 6 (IGFBP6) |
USD 396.00 |
|
PH304060 | IGFBP6 MS Standard C13 and N15-labeled recombinant protein (NP_002169) |
USD 2,055.00 |
|
TP304060 | Recombinant protein of human insulin-like growth factor binding protein 6 (IGFBP6) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review