IGFBP6 (NM_002178) Human Recombinant Protein

CAT#: TP723174

Purified recombinant protein of Human insulin-like growth factor binding protein 6 (IGFBP6).

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: Hi-5 insect
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
• Tag: Tag Free
• Predicted MW: 22.6 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Determined by its ability to inhibit IGF-II induced proliferation of human MCF-7 cells. The expected ED50 for this effect is 0.1 - 0.4ug/mL.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002169
• Locus ID: 3489
• UniProt ID: P24592
• Cytogenetics: 12q13.13
• Refseq Size: 980
• Refseq ORF: 720
• Synonyms: IBP6
• Summary: ''
• Protein Families: Secreted Protein