Il12a (NM_008351) Mouse Recombinant Protein

CAT#: TP723185

Purified recombinant protein of Mouse interleukin 12a (Il12a), transcript variant 2.

Specifications

Product Data

• Species: Mouse
• Expression Host: CHO
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  p35Subunit:RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
  p40Subunit:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
• Tag: Tag Free
• Predicted MW: 75 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: Assay #1: ED50 was determined by the stimulation of IFN-gamma production by murine splenocytes co-stimulated with IL-18 is > 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. Assay #2: Determined by its ability to stimulate the proliferation of 2D6 cells. The expected ED50 is <0.1ng/ml, corresponding to a specific activity of >1 x 10^7 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_032377
• Locus ID: 16159
• UniProt ID: P43431, Q549G3
• Cytogenetics: 3 31.92 cM
• Refseq Size: 1272
• Refseq ORF: 645
• Synonyms: Il-12a; IL-12p35; Ll12a; p35